PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AL_A8AF980F3.1
Common NameMYB13-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 152aa    MW: 17360.8 Da    PI: 11.238
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AL_A8AF980F3.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.15.5e-152976148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed +l+  v+++G ++W+  a+  g++Rt+k+c++rw +yl
  Traes_3AL_A8AF980F3.1 29 KGPWTEQEDMKLAWFVRLFGERRWDFLAKVSGLNRTGKSCRLRWVNYL 76
                           79********************************************97 PP

2Myb_DNA-binding58.91.1e-1882126147
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                            rgr+++eE+ l vd+++++G++ W++Ia+ m+ gRt++++k++w+++
  Traes_3AL_A8AF980F3.1  82 RGRMSPEEERLVVDLHARWGNR-WSRIAKAMP-GRTDNEIKNYWRTH 126
                            89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.4172476IPR017930Myb domain
SuperFamilySSF466892.53E-2927123IPR009057Homeodomain-like
SMARTSM007171.1E-122878IPR001005SANT/Myb domain
PfamPF002495.4E-142976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-203082IPR009057Homeodomain-like
CDDcd001671.25E-83176No hitNo description
PROSITE profilePS5129425.02777131IPR017930Myb domain
SMARTSM007173.6E-1681129IPR001005SANT/Myb domain
PfamPF002492.1E-1682126IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.8E-2483129IPR009057Homeodomain-like
CDDcd001676.98E-1184126No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
MKTKQASKAK AAPSPGKEEE AVASGGFRKG PWTEQEDMKL AWFVRLFGER RWDFLAKVSG  60
LNRTGKSCRL RWVNYLHPDL KRGRMSPEEE RLVVDLHARW GNRWSRIAKA MPGRTDNEIK  120
NYWRTHTRKL HKDTRASAAS ASTTTSTSMS AA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C3e-28291294103C-Myb DNA-Binding Domain
1mse_C3e-28291294103C-Myb DNA-Binding Domain
1gv2_A3e-28291294103MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-282012949157MYB PROTO-ONCOGENE PROTEIN
1h88_C9e-282012949157MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF2889340.0JF288934.1 Triticum aestivum MYB13-1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232888.12e-71PREDICTED: transcription factor MYB59-like
SwissprotQ4JL761e-63MYBA2_ORYSJ; Myb-related protein MYBAS2
TrEMBLW5CFM41e-109W5CFM4_WHEAT; Uncharacterized protein
TrEMBLS4V9N01e-108S4V9N0_WHEAT; MYB13 transcription factor
STRINGBRADI2G62510.16e-71(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.32e-61myb domain protein 59